TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0RHE6|F0RHE6_CELLC Uncharacterized protein OS=Cellulophaga lytica (strain ATCC 23178 / DSM 7489 / JCM 8516 / NBRC 14961 / NCIMB 1423 / VKM B-1433 / Cy l20) GN=Celly_1360 PE=4 SV=1
MYTKYSMASRLKNIYLISIFLVLISLPLSMRFNNFVLGFSVLLFIIRYFKDKNFFQPKRVLNINTMLVVSLCLIEVLGLL
NTENLGKGIKEIESSLSFLFIPLLFLSNDFNDKKNIEYCYFSIIIGSTLLVLISWVCIGMSFIAKYDFSITYLFSNEYTY
IGLAKYVGAHPSYLSLIIIFSIGLLFPVNDRNYKRRNVRIGLVCIHIIFLFQLLSRAAILYFIFVALLFLFKKRLWKHLA
LISLVFTFITYHGYRNEYTKNRIDSFVSIFKEDTKSWRFERMKLMFEIFEENPIIGVGTGDISNFRKDKYLDNKHFFAAD
KNYNAHNQLLEYLTTFGVIGGVLYFSIFFNFFYRCYKLKLWVYMFVLGAIFIISFTESIFERYMGVEFFAIITSLIVIKT
LENNND