TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4Q5A9|F4Q5A9_DICFS DUF590 family protein OS=Dictyostelium fasciculatum (strain SH3) GN=DFA_08152 PE=4 SV=1
MDENGIPLDQRNSYYQPNEADPNAATLQQQQQQQFQQLPDNNRYSFHQRSPSLLPDEGFYLYTTAPEYIAYSELNMKEKI
LENMFGYTVRGKKAAIPDGYMVDYTRFGQPYLLAHTDKTGGGDSNGEPVDPTDILAAEEHQKHNLTMRCTTQQIEEKFGI
GIYLYFDFIKFCLLINSILLCGVLINVVPHLYYENDVSLFKDFTSTDMVFVAINLASYIHDDYKQLYYWSTVGTIILSFL
MGPIYALKVHHYFKKQKLEDFEDGFTGDDVIRGNERVSSRSRAFRFAVSYSVFIILIGISAICTVYVLKTVNNYQFLANI
LTTSLVSAIILRVINVIYEFMCLYLTKLEGHRTWTNFRNHNTLKLFVFKVINVLVLYILRDKIFRDITDQVVQAGCPLID
VGSQFFFILLMDLTLQNIWEIVYSVGMARIGRCIGKRGKKSTDSYKPEFDLAEEYLELLYRQFIVYLGIPIYPLVAVFGV
LCNLAEFYVDKFRLLKICRRPHRVQGSMKRFLSFYLLIIAVVSVVSYPYGSGWVLVQFGFDRGDLNANCPQLFSNNATLL
LGTNQFGGW