TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8AGU2|F8AGU2_PYRYC Putative uncharacterized protein OS=Pyrococcus yayanosii (strain CH1 / JCM 16557) GN=PYCH_15620 PE=4 SV=1
MKRKVTLILGLAILLGLLWWAGIGETMDILKGAQPSYFLLAAGMQAIALLAWAVRWRTFLRRAGVHVDFLRVLEGVMIGI
FVNNLTPGARTGGEPAKAYFISKRSNGSYPQVFATVMADRVLDVIPVVVFMFLAFNYALKLRIGLLLTVLIVSIVLIIIA
LSLTLAFSVHEGAAVRLLMFIARLVKRISPAKLSEADDVIEGKLRRAISEFKRTLRELGKDKGGLIISLLWSFTLWSASV
LRTYFVFLSIGYEVPLAYVLLVQMAAMAIAMMSVIPGGLGVNEAVLSALFLALGIEKSIAVSATILDRLISFWIPTLIGG
VLTLRQGAPH