TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8LI02|F8LI02_STRSL Putative salivaricin 9 ABC transporter; contains an N-terminal protease domain with motifs characteristic of lantibiotic proteases OS=Streptococcus salivarius CCHSS3 GN=sivT PE=4 SV=1
MKVILQNNEEDCLLACYTMLLNDLGYKVPLYEVYERDSLPADGLSVSYLLTLNKNFNVDIKAYKANFDEVISLIRVRGNN
RVIVHWNNDHFVVLEKITKNYIKIVDPAIGRIKFSKDEFLEHYSGTVITVLPTVDFHRQKVRTLFFKYFKNTLEVRAIFS
FLISLLLIEISVLLFSIVIRNMVAGNLKFIASLLLLFTIILLQIVGYYIKNFALEKYNSNFDKSYTTILFKRLLNKPLLY
FRNHTNGSISEKISFRTTLRDSVATKLIPSIVSLVSSFVIFIYLVIISFRLTIILVSMIVLYSLISSVLYYKQNEYNQSY
LQYLIDFNSDFQSDLEDIDYIKVMRNERETEDRWTKNNDRLTSKYSQILKVENFVQLFGSIFSYFSLSIVILAVIYNNKF
FNVSIADLVLYQTSISLLISSIEQVKTSIFEIARLAIYAEKQGDILKENLPINVNFDLDSNYIIQTENLNFGYGNESLYK
PVNLKINQGEKIAIIGKSGSGKSTLLLLLTGMLRHSGKITYNSEHLENYMGVILQNMTLKKGSVLENFEYDSPDLTKLSK
ILVDTTADEVIAKLPNKLQSKLLKQGKNLSGGQIQKLLIAKSLLKGEKMIFWDEAFSNLDEMSKDKIYENVLLGSFYKDK
TMLIVSHHLDIVNYVDSVIFINDETGEVIKSTHEDLQKNNLDYKRFICNKGV