TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0IP52|G0IP52_BACAM Putative ABC transporter (ATP-binding protein) OS=Bacillus amyloliquefaciens XH7 GN=ythP PE=4 SV=1
MGDLLNANIVSAGYADRPKVISNVSFTVNSREIAGLIGANGAGKSTVIKAILGLSRDMEGCIEWNDSSYAYIPERPSFYD
ELTLWEHLELTGSLRGIESGAWRERAGRLLDEFSLTAVKHELPSGFSKGMQQKLMLMQAFLAKPDIYIIDEPFIGLDPIS
TKLFTDMLIAEKERGAGILMCTHVLDTAEKICDRFYLLDQGALLLQGALEELQERTGGRSLLDCFYSAVRGSQR