TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0K0M9|G0K0M9_STEMA Uncharacterized protein OS=Stenotrophomonas maltophilia JV3 GN=BurJV3_2103 PE=4 SV=1
MHTLMRITPLALAALAGTAFAAPPAADDGADVQALANQLEQLKSNYAQEVRRLRELDMQVQAMQARLSGKVGPMAPSTTT
TTAVEHGSTLQTSPGGEGYASSAAEAQQAKQESRRSVDDVKQQQSALFSRRFTVENSLTYARYDRKQLTLNGFLALDAIF
LGNIAIENVESDSLTYNLAARWGVSPNLTLNLDVPYLARRTVYQKGGAGGAAAAIAQEETNGNGLGDIGLSANYRLFGER
GWRPETVLTTGVTAPTGRAPYGLDWKVIERDDDDYIRFAVPKEQPTGNGVWQANVGLSMVKTADPAILFANLGYVHSFPR
GFSDIDSNPDTVNPGDVKLGGSVYFGAGVAFAFNERTSLSLSFSDRISARASTRFQGGKWMKVIGSDANAASLNLGVTYA
LNQHTTLVTLLGIGLTPDAPDFTLAFKIPYML