TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G5L3C3|G5L3C3_STRSU Uncharacterized protein OS=Streptococcus suis R61 GN=SSUR61_0118 PE=4 SV=1
MTDVINLNHMNINFETLTDQDLSEALGGKSAAYNAGYYTGKIVQLGLLVVPFL