TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G7HRD4|G7HRD4_9BURK DUF1275 domain-containing protein OS=Burkholderia cenocepacia H111 GN=I35_6472 PE=4 SV=1
MQPAQVTAAGAAAPDRVRGEDVFLASIAGYVDTLGFVALFGLFTAHVTGNFILIGSGLAGVGQGLVIKWLAFPAFIAGIV
AARVLDHRMRVRGHGVRARSLYALQTILLAGFMLAGVAASPIGSADAPATIVCGLLGAAAMGVQNAHGRLTARTVVANTV
MTGNVTQAVIDAFDWLVPIAAPDEREAARARLRRTLPPVAGFALGAGAGASAYLYAAFWALALPLALLCFLTWRAGRTGE
PSVSR