TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G9Z5W2|G9Z5W2_9ENTR Uncharacterized protein OS=Yokenella regensburgei ATCC 43003 GN=HMPREF0880_03090 PE=4 SV=1
MRNLTENEYSFISGGGSDKGSFGVSKETFGGAIGGAIGGAVGGIPGAAIGTIAGAAIANGSRGTGSVGPSGIPWGGSNGG
GVMWGGSSSSSAGSGS