TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H1WT91|H1WT91_LEUCI Putative uncharacterized protein OS=Leuconostoc citreum LBAE C10 GN=LEUCOC10_09650 PE=4 SV=1
MNDSFKTLRTYEKVTPSELAVVGGGFNKLAYDIGHGLGVVINIYSTLKGTRRGGHYKPRH