TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2SME2|H2SME2_TAKRU Uncharacterized protein OS=Takifugu rubripes PE=4 SV=1
MSNPAFAYYPGDQMLHFYRWTSPPGVMKILCIIIIIMCVAVFACVASTLAWDYGYGGSYGGSYGGSYGGSYGGGGYGGGV
GGGSSYGYGGAQMDPKAGKGFIIAIAAITFIAVLIIFVLVVSRQNAARSPKFYLATIIIAAILAFLMIIATIVYLVAVNP
LAVGSAVRLAVRLVGCMCVYSCPVLGDATFSLHRPLVDPQQAIAIVLGFLVFVALIILLVFAVKTRSKIRRWGQERILWE
EVKVISDGPRHSVDEWVSGNIKYGIKSSEKQERGTFTFPHWEASPVPTLPWPLALAPSPGPYPDSERAQGGSDTERAQGG
SDTERAQGGSDAERAQGGSDTERAQGGSDTERAQAMKSRVKDYESGVESGDDLEDEDFSVAFPPIVDEEERLSYKREFDQ
DHQEYKSLQAELDNINQVLAELDREMSAHAEGSPQFLDAVDEYSRLKNIKKSSNYLIKKRRCKHLRAKLSHIKRKISEYD
HRP