TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H6WS94|H6WS94_PETHY ABCG/PDR subfamily ABC protein OS=Petunia hybrida GN=PDR1 PE=2 SV=1
MEGGEELFRVSSARLSSSNVWRNSAMDVFSRSSREADDEEALKWAALEKLPTYLRIRRGILTEEEGQSREVDITKLDLVE
RRNLLERLIKITDEDNEKFLLKLKERIDRVGLDLPTIEVRFEHLSVDAEARVGSRALPTVFNFTVNILEDFLNYLHILPN
RKQPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLLLALAGKLDKDLKVSGRVTYNGHDMNEFVAQRSSAYISQYDLHIGE
MTVRETLAFSARCQGVGAKYEILAELSRREKEANIKPDPDVDIFMKAAWNEGQEANVVTDYTLKILGLEICADTIVGDEM
VRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVNSIRQSIHILQGTAVISLLQPAPETYDLFDDIILLSD
GQIVYQGPRENVLEFFEYMGFICPERKGVADFLQEVTSRKDQEQYWARREESYKFITVREFSEAFQAFHIGRKLGDELAV
PFDKSKSHPAALTTKRYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMASITMTLFLPTEMHRNTTIDGAVFLGA
LFYALIMIMFNGFSELALSIMKLPSFYKHRDLLFFPPWAYALPTWILKIPITLVEVAIWVCMTYYVIGFEADVGRFFKQL
LLLICVNQMASGLFRLMGALGRNIIVANTFGSFVLLTVLVMGGFVLSRDDVKKWWIWGYWISPMMYAQNAIAVNEFLGKS
WAHVPPNSTSTETLGVSFLKSRGIFPDARWYWIGAGALIGYVFLFNFLFAVALAYLNPFGKPQAVLSEETVAERNASKRG
EVIELSSLGKSSSEKGNDVRRSASSRSMSSRVGSITAADLSKRRGMILPFEPLSITFDDIRYAVDMPQEMKAQGFTEDRL
ELLRGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGTISISGYPKQQETFARIAGYCEQTDIHSPHVTVYES
LQFSAWLRLPREVDTATRKMFIEEVMELIELIPLRDALVGLPGVNGLSTEQRKRLTVAVELVANPSIIFMDEPTSGLDAR
AAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELLLLKRGGEEIYVGPLGRQSSHLIKYFEGIDGVPKIKDGYNPAT
WMLEITSVAQEGALGNDFTELYKNSELYRRNKALIKELSVPASCSKDLYFPTKYSQSFFTQCMACFWKQHWSYWRNPPYT
AVRIMFTFFIALMFGTIFWDLGSRRERQQDLLNAIGSMYIAVLFLGVQNATTVQPVIAIERTVFYRERAAGMYSAMPYAF
GQVMIELPYLFLQTIIYGVIVYAMIGFEWTVAKFFWYLFFMYFTLLYFTLYGMMTVAVTPNQSIAAIISSAFYAVWNLFC
GFIVPKTRMPVWWRWYYYICPISWTLYGLIASQFGDIQDRLDTNETVEQFIENFFDFKHDFVGYVALILVGISVLFLFIF
AFSIKTFNFQKR