TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H9H2J6|H9H2J6_MELGA Uncharacterized protein OS=Meleagris gallopavo GN=OCEL1 PE=4 SV=1
VKSWPGLLRVLGGLQLLCGGMAFICVCADIPRGHSAYSSELLLGGGLGVSLTPFVLAVLGLAWLLTALLLGLGVTARHHR
VLLGVTWWPPMEAGLHVLLFLLCLAAAGAHIHTVTLGGLCSSPLLGSPLLTQLCLVEGGQAAALLFLFLTALLYLAGSAV
ALKVWHEVARWHRGAAVIPCSPEDSLQPAGASCPPVCVLKPLLVPAKRVVFEDEVGTARRPPRRAGGHHHRRWRAAGGVG
SVPPGLVPQPRIIPDYVVRYPAIRSARQRQQYGAVFADQHAEYRELQGELKAEQCGDAVCHLQRPLSAPWDEKGVAHLCC
EFLGKKRAVDLAFVAKRQRCLYLKEKLTHIKAQIHEYDR