TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I0FEC7|I0FEC7_BORCA Holin, BlyA family-containing protein OS=Borrelia crocidurae (strain Achema) GN=Q7M_1125 PE=4 SV=1
MNTVFDFLSNIAETKLIIIGIITLFILIPLALFLKPVLAEIVKMIKHLLKYLIDKQSKNKK