TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I0II84|I0II84_PHYMF Putative major facilitator superfamily protein OS=Phycisphaera mikurensis (strain NBRC 102666 / KCTC 22515 / FYK2301M01) GN=PSMK_28130 PE=4 SV=1
MSRSATLPNPLAGFRTAAQPPMTRQAYHHEIRAAMTVPFALALLEGGVIAVVAKNVFGVGNLGFATIVAAPMFANLTSLV
WTRVARGKPKVAVTSWLMAASLVLVAAIALLPTTGPGPSLLVVLAVAARVVLAGVVNVRSTIWRMNFPRSLRATITTKFV
LTATVILMAVPLAVGPLLDWRPWSFRVVFPLAAAIGFLGVRSFWRVRVRGERRLLRDERRPHEADAPRQASGKPHTVWSV
LAQDRVYRFYLACQFAGGVANMMAITAFTLMVIEHLAAVAPRTQNTQGMLISAAVPLLIATLSMPWWSRRLDANHIARFR
IGHAMTWVLNQSVMFLAAWFASLPLMYAAAAGWGFMRGGGVLAWQLGHNDFADRRLVPTYMAIHQTLTGVRGAFAPFLGT
ALFAGWPAVERVGLPAFGGIGAWLFAATAGLSFLSWLGFVFLQRRLAAAGGGRAEDA