TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I3JWG5|I3JWG5_ORENI Uncharacterized protein OS=Oreochromis niloticus GN=LOC100695523 PE=4 SV=1
MYEPRYYDSPPVYSPPYSTTSHSLYPPRSVQSPRSQNVPYTYDVPPESYYMEGKPQHFYRWFSPPGFVKTFQGATVLMCF
LIFALVASTLVWDMNRFGYGGYGVVDTGGVGGLGSGYYGGSYGYGGSYMTPQSAKAAMISMAAINFPVSLGFLVASFSRS
RSIRTCRFYLTVFICDIILAVLQGIIDIIFVIGVNPMSQSSQSMLYNPMLMMCQNIQGSPSLSGSVGAGFPGGFPLYNQY
LQHYCYMDPEEAVAFVLGLLVVVALSFSAYFAYKTRSKIWRHGKANIHWDEPVARPSEGQDIQDWVNHVGEVRSTQQAPT
VVVSERAAPDLRAENSVVSYGNGAVSIHSEGNYKTNSVSANKSKTHGAEPLYQNCRAIVCPSSSSDESDSIRPPPYYLKK
ERKKDREPMPAAQATIESQYETGYTTGDTGNGLDRDHTDYLYRLYPEITSDEQRRKYKKDFDSDLLRYKILCSELDDISD
KMHKLSRELDALEEDSMKYQGLADEYNRLKYLKSTPEYQAKKKQSKELRQKLFHIKRLVKIYDQGFC