TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7LJ17|I7LJ17_METBM Uncharacterized protein OS=Methanoculleus bourgensis (strain ATCC 43281 / DSM 3045 / OCM 15 / MS2) GN=BN140_0619 PE=4 SV=1
MRPFARFLARARARQFHYLLASLILLLVIYPYVVAGPTGPIALTVLSSIILITGVYAVSYRRRQVVIAVLLAVPAFLLGW
LYLATGVPALDSAGSVFTVLFYAFTALIVLFRVLTTKKITTDTIYGAVSVYLLMGLTWATAYDLVESIHPGSFTADPGHN
PDGTFAFPEFIYFSFVTLATLGYGDITPITNQARSLALLEAASGTIYIAVLIARLVSALGWSPETDRE