TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7MI73|I7MI73_TETTS E1-E2 ATPase family protein OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00145530 PE=3 SV=1
MGKQQKLFLYKKKQGLISKTQASKKSQIQQKENIIEQNRVMDEQELKINGQIKIINSQIEGECYIQEVYALKQQQYKQFL
VILLNIITFGGYYLLENWYERSLLKLRYCYTDDIKQATHFLIVQLDNTFQIVKHFEIQLQSAISFDNRFLRYIYSEEEKY
FKCIHFNYTNFLEKNQLGRKGLNQQQLQLLEQCYGKCIMQIPIPSYWSYLHKELINPFFMFQIFSVCIWAYDDYYAFCIA
ITLILSISTASNICQIRSNLASFTKIAFYETEIMIKRDKIEKQTSSNILPGDLFYINDQMKVPCDCILIQGQALVNEASL
TGESVPVLKYNYEFNEEVDKKCILYEGTSVIQIQNNTSEHGCLALAIRTGFTTHRGQLVRSILFPRPHSFKFYEESIKFL
KFLFALTFVAFAILLPRLYQTMELHYIALKLTDLLTVTVPPSLPFALQVGVVFSMQMLKQKKIYCINSEKVVVGGRVDTV
VFDKTGTLTEDRMDLKGFLPIDDNGNFFKNELVKEDILNVFQKENTQHISKSMQISLNCMGSCHSIMIRKNQQCSPKQDA
LQNNYKNHLIGDPMEIQLLNISGCKLYANGDISSSFGQQFKIIKTLEFSSERQKMTVICEDKSELIQENKFLYVFSKGAP
EAIHKICNNYPKNYNKMLDKYTQEGLRVLSLAYKKLPFSLISQFQQNSSQNTDQNNSNVNTNNLQPESIESEMNFLGFVF
FENPLKEATAQTLQQLKEAKINIIMATGDNPQTALSVGEKCHFFDFEDNVTFINLAQLGNNKRLTLTNSKFNTYAEVSEV
DELDEYLSDELSSFNSTDSQENKDQSEQPFGKDKEQLKLLKSLKQAEELNSQGRPRDLISKNENDERKKLSNKESSQVDD
IELKDNILIQQKSSGNKSQTKDILNGEIKQKCKVNEKQDQLYICDKNSTTSSSQKIGDESIDIENDQQLNKQSNSNSSED
LKEEPDSLHLPISQYVLDSFIREALNQKSEGFVMNGAVFDEIYFKGEINDLSLMLLEKTRIFARMKPNHKTYLVELLQKR
AVAMVGDGANDCGALKQADIGLALSQLEASISAPFSGECISNIIEVLIQCRAGLKTAFNNFNFIAMYSIVQFTTTTILYY
CFSMQSDLQLLYIDILVVSSLILTMGTTNQLSNINSMTSASNKLSMQLPDQSLISLKNMLSLGGHTLLNIITQLVILFLL
SKQSFFEGIEANKQFYEKEDIMTWNSSEVSTLFLFSNFIYLALSICYSDGKPFKNNFYTNKLFICNFMVLLAYCIQMCLV
PSLNYYYFYINTSMSFSWCSFMCIAGIGYILLSYFYENTLLANSEGNSIQNLVYYLLEAFFFVSAAPLAIMSDNVLIISA
CLLVQLMFYIIVIAALQFFASNIFLQSILFGRLLVMMKNWYSNKKLVLCVGLTYFLNEFFSILTVYWDQGIANQGLIIQG
KPSIMGLSIVNEDDEGQQDQSEANQEQKKEKHQNQQGGIIQNVWGLNQSFVKKVYEDDNDAPKINFFKQLPQLKHLLFFF
ISSICLKLFDWYTRNQLLGSLQPFIDQQDFSKYIFYLGMFGLGGIGGIVALGIILDVRNQEFTLRMAICSAIGLSISYIS
SLLYYYGIIPQLAYEILVGAFEFSFYCTYQVGVPIVLVFDLLRYGDFSYLIIPIFSALDRIVNALFNIFNKEPQNWTDSS
TVVQPLCISLMFLSLMIQYLKDRQRSSKNFQEQLDEDDEDEVQGKNTNNLLSEILEDRKGDGDQSNLNRSTSKNLTKNNF
KIQISSDDALSQDIHEHQFKNSLEQDTKFVIEKRNVSLKDNISSDFE