TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I9U3B8|I9U3B8_BACVU Uncharacterized protein OS=Bacteroides vulgatus CL09T03C04 GN=HMPREF1058_02776 PE=4 SV=1
MYFIWYIIIGIIAGFVAGKLMRGGGFGFFINLLVGIVGGVLGGWVFSLFGIAATGIIGSLVTSIVGAILLLWIVSLLKRS
DIS