TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J5PL79|J5PL79_SACK1 RSN1-like protein OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=YMR266W PE=4 SV=1
MNSSNSTNSTATASSTDTSTQQVVTALVSNGAIFGVFIVAFLLLRMKLKRIYEPKSSFDLTNEEKKPEPLPRGIWQWLKP
LLKKSDNFIIQQAGLDGYFFLRYLFIISIYCAVSIIYIFPILLALNASGEGTSQTGLNELAYQNVKHRGRYFGHVFCGWI
FFWGFLYIIYRELYFYTSMKHAVLASPRYAKKLSSRTVLFQTVPKQYLSEEEFSKLFDGVKKVWIARGSGDIESMVKKRD
GMALQLEGAVTQYMKSALKKIEKLNKKNPQLCISDNISEYIPDKKRPHHKINKVAKFFFGKKVDTISYIKEELPKLNAQV
KELQENHENAQPFNSVFVEFESQYQAQVASQITTYHAPLFMTPARVGVEPSNIVWFNLRMLWWERLGRRVTSSAVIVALV
LLWSFPVAFVGMISNITYLTNKLPWLKFIYKLPKPLLGLLTSLAPTVALAVLMSFLPVFIRAMAVAQGSPSKQNVEHFTQ
QAYFAFQVIQVFLVITISSAATSVVTKIVQDPSKAMDLLASNLPKASNFFMSYVIMQGLSISSGALLQIVPLILFYALGA
LLDGTVRKKWNRFSGLPSMQWGTIFPVYTNMTVIIFSYAIISPMILLFGAVSFFLLYVAYLYNLTYVFQESPDGRGIYYP
RALFQSIVGIYIGQVCLLGLFAVGKGWGPIVLQVIGLCVTVFIHLHLNAAFDHLTKVVPVDTMKPLDGVSDTPSFKNIYQ
GTGKGIGKKNNFGTNINMDGIKELPEFPIKKYHKRTDSVTEQQVDNSLFSENTFEYQFNPANEVNAGHIIDAQNIIEDVP
LLADGDTMNIPSAPWWKRFLKPHIYYSYKALKSRLPEIYGLIDPDEKVNEFDIAHAYDYPAVSAQCPVLWIPKDPYGFSK
ALISDVAGVVDMTDENAAIDKELKFTLRDIPPSYEEVKSEDADEAIHRSNDEYKDAKEEGDPFADFNYKGEENRSPV