TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9I8L9|J9I8L9_9SPIT Uncharacterized protein OS=Oxytricha trifallax GN=OXYTRI_02066 PE=4 SV=1
MYPTYDDPNVKKYADYVGRDAQVYLDGLNEYSNFKSLNLQNIGMGDLLRHGNDYKYLQKQSDPNNPMTRARATDSQIEPN
LNNRQNNNYNTETGQDQNNQFNPFITPFENNQNYSKPQTNQRPQSSQQQNNVRYANNMDTRRMADRQKLQSQKINDPYNP
NNYIPPPKQVNQVPVQPPKTEFDQIREHEQMEKDRREKDREKRKMQAQHKRDNQRKYEAQAKDFEYPQPRGFNDPFSGKD
DEFDDKVIQKFGADGIQKHLAGDDVKLPDNFFHPEEKVIMNLPESHKQQNQSQNPFNRDISNQFPTRMPMALPDNDTLAK
KNKELTQKLLQAQKESAKQQVQIEELVNKVKDLDQFKNKLKESLLEMNQKKMDNENNETERSYDSSRPLNKTKMADLDFL
REMRNKQMQSDRDTFRKSLFNGVDLIDDVNGLKAYRKKMKKNVCQKFIEYISQNFDKLVPLASDVKKIGLRYDKSVESYY
TFFRYLVGLAILTFLIFLTMQIVYLYYLWDTRTSFCVRIIPCMLLFSRYPNGKELYYIFTLIAFILFVFVCNMYKWMNFD
KKMRWDDLNGDKEKVISKIFFNAWDWSTDTQSELLELKTAKLREVKLTVEEEKIKGRIKNRTKKEKAKLIALRTTTFIIS
FFILCSGWAAIVAVYLYEADIESYFTHINIIKYIASFIPQLVITFVNVMIPAALLKVSTYEKWDFVKDLINQSYTLIAFS
PTTYDCREDQAGLNMVKLSSNSHQTGSNIMILLNISFMLIMIYYGCLLYIPVSHEQYYFNPNKQCGMFESETYMFNDLDT
LLTTNGSILLWIRYIIFFYPILYLLIMILASALKFKTNHIQILKLSLIERQQASQLIIDELQGKLGQYKKKLELNKMM