TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9IU59|J9IU59_9SPIT Anoctamin-like protein OS=Oxytricha trifallax GN=OXYTRI_16388 PE=4 SV=1
MCQRKQEITQIEFLDYCKDGILDLVKTTYNSYHDKAKILKSIDEDKKTCLHLVSYFGHDDVLEFLLEEYKVVGLNIDLQD
AMGFTPLLYACYRGYDQQEEEAAECRIACVKLLVDAGANVNFQKYRTNLTGLHWAAFNNDKLVVSFLMNHGAELRYSFTD
ETPLDVAGYCQNEEIVYTILNQWWQNQFKSLPSVQNDIRDDSSLVKEKLLKSYKMGQITPLSEDLEKVPSGFNVLLKYDT
REQSLQFDHSIIFRVLYWASVQGMNEIVGYIIRLGYSPFIRSFEQKNALMAAVESGQSETVKFILNFTYTPTHPLEFEQS
KLKTDANGNNPLHLAHKINHHDIAKVIQEKNAGNPNVRNYRGLLPVQMNHKKLFDENEFDAEPDYCFIVKKARAAFLIQQ
LIELQLVVKEFASALNKTETILVIFFSDDLLDKMAEIHDVRVRLLDLGQTIQFKNFAEEIYEQFQARQKQFLMMKIFDQE
IDLDYYKKVGVIVDHFPLHDAFKDTIQQSWKEYRVGLFFGMVTGNYGKYMQPLNFIANYYGEKMSFYFAWLLFYTSWLML
PALPGIALFIYQMVNLYDQSQNDKKMTLDNPYNCLYCLILAVWSTVFIEMWKRRESEIAHMWNMKDFQDVDAEMPDYRAE
IVIDKKTQSIKKKNFSDPSSRRLMGELPSVITGVAIIVACFFGYYTIRRDHNGETSYSVGSSVINAIVIIILGTIYRVLA
RVLANWENHKYAEDWENSLITKIFAFQFVNAYISLFSIAFVDQEFNQLAQSLAIILAAKQVAMNCVDIIVPWIKVSMKKK
KLTQIFASDFSGKAKNPEDLKLQFFVESQCILQSESNILVMKYSEVMIQLGYVVLFAQAFPLAPLFCILSNMLEMKGAMN
LMAFYQKRTIAQGASGIGAWKGMAEILSYISIGVNMAIIYWTSDSIDEITGFQYTKVEQFMIVVLIEHVILAMKLMLAVM
IKDKPEWVVQAEHEQQDQLEHLYDVLDDKAEEFKAKGGQLLSDQINEMKEANRVEQLENIRNEGTISQKTAEEEDEEYKN
EHALKYQGKKDKKKLKKQKKITLQELQKAQDHSKKKDKKDKNDSSRDKHNKKDDEKKMKDLKKELILQRMQGGDDVELVQ
QDLKQLLQTNNNATNLNNKTQNHSSHENLMQGIKLTDNQPSLDEWNIEEKNSKRDHKDKGPKDKDKDHNKDKDHKDKDHK
DKKDKDIKDDKNVRNSYASIGSKDKDKKHNKGNKSDSEDEKKQKKLNKSLDSLDSDHGKKNKDKKKH