TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K1LIH9|K1LIH9_9LACT Uncharacterized protein OS=Facklamia hominis CCUG 36813 PE=4 SV=1
MEIIKGLVEQSELIAIILIPIVSGFVQVFKNTLNLQDRYVPLLSLIVGATIAMTVMLSAGQSLNSAIIVGLISGLGACGL
YDQKKIGDGGSKNA