TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K9A5I7|K9A5I7_9BACI Uncharacterized protein OS=Lysinibacillus fusiformis ZB2 GN=C518_2626 PE=4 SV=1
MDLTNIFMIAMMMVAIVLAVAEVLKKTFNLNTQYMPITSVVIGIFIGLVLWPLAEFPLYVMLISGFIAGLTASGTFDLLK
AAKKEGEQ