TCDB is operated by the Saier Lab Bioinformatics Group
>KJF15500.1 hypothetical protein AXFE_36460 [Acidithrix ferrooxidans]
MVSLESDELHSLKTNNSARSSNGIRGLKSNRRARRILGSAFAIGVLAFGVYVISGQSGELGGSLELIESAQWPYIVLAIF
AEGASVLAFGIFTILLLRTRLLRTGFFHPVAISIATTTINNCVPGGTAFSSIYSFREYRQMGADSIFDSWVIISTNLLSG
AGLAVLALIGVFDSIRSSEFLDLILVIPGVLVVMVGLSWLISSPSILIKIIRPSLALTYRLIRLPRGGIGEVDALCQSFQ
ETRPTLRRVLLATFVATLNWVFDASVLVLAYYAINQSIPWRGLLLAYGAGQLAANLPITPGGLGVVEGSLSIALVAYGGA
QESAVAAVLIYRLISFWMTIPIGWGAYLWTSFARRRSSTPIAESLPVEILNGDLNES