TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L1LFC7|L1LFC7_BABEQ p-type ATPase family member protein OS=Babesia equi GN=BEWA_040990 PE=3 SV=1
MIYYSFILILRLCCISVHSLDPVHNKVGDAVLSFDRDVIDHSTGHPSTNSIFLESLNKGISYNDKIHGGIGDLGSGVHLQ
HTSDPNDGKDNEKPKDSKDIEDKNEQKIKPILKNDDTGPIKPPIFNNSRWCKADVCLVSVPELLLFNALSVLFLLFLVIW
HLGLLLRNKGKYEGYTDLSTVRSNTPTNDRRTLLQEGYSYTLPGWILLRYIILYTAICQVFVLSFVCNELCIPMIDGVKH
WDMRAKPFFISWLIGFLTLLLSFLFKNTKVGKYLFLARSPLHSCEIVLISDFSKSSASTTVDHDILSLSLHWISTFASYL
KLMLNISDNILKVPFEKYKASVKHYYIDVKSNDTERYFFYHYVKYTYSHDSAYFVDAYCKVSNYLKNTNLIDLLDRGGLT
ELESMKRTEDVGKNVISVEKLPFSTLLHREISDPIFFMQLYLTLKSIYWRSCITAPIWGFTSLYTIYKKVKIIHDQQNDI
AELATSSANRLVTVLRENVTRVVPATDLAVGDIVRVDSDWEAPSDMIMLRGDAIVDESSVTGESIPLRKTKLAVDKYNYS
LSIFDLNIDLDNDDMVNSKSADEGLNDHLLKAGTRVVAVLGNDETVGSAVAVVIATGAFTTKGKQLKGVLFPNQFRLKYD
TQLPTVFILTFIYAIICSYYQIQFLGWNMTSIFYSIGTLSQVVPVWTSTIISISQSRACQRLSKSESVYCIAPSRIAVCG
KVRVMCFDKTGTLTNNSLIFNGSRFVVSRGNTPIMSPDEISPTLDTIKSTKNMATNKDESTIRQIVSLAISTCHSLWPSN
TNEQFGNHVDKSMFSSTGCTVEQFIDEGGATRRFIRNFSNKDLVMEVLRTFDFDYRKKLSSVVVAVTVESEEPLIFAFVK
GAFENVSNCCMGGNSDLGFVANAESSNGSYVLGLAYKIIENENIDERDEVENNLKIGGLLLFNNEVRPESLDIIQSLHEA
KVRPVILTGDNIAASQYVARTCGMFTLQSQAGPIAKLEGGDIVWLYPHHVVDEERLFFTDDYHDLSLTGDAFDHIQTNWG
NILKKNGRLTSNQTANDNLFEQFLLRVRIFARLNPHQKVRVINAFKSLEIITGMCGDGTNDCLALQASHAGISLTSGATS
MVSPFSSKNNKLESVISLIREGRGSLVTSLACFKFMLLFGLMIAFVKVTLFRECRGVMPEWGYLLLENAILLSLSYTMAM
SRPSDKLRIRSPTSSLLGPLTLFSVGIMFFINIFFLSLIFKLYNYLGVPSSLDFNRKMNKAAWWILSDNFESPTICLWLC
YQVVNTALVFSFGGVFREPILRNHSFTA