TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M0MYF1|M0MYF1_9EURY Ion transport 2 domain-containing protein OS=Halococcus salifodinae DSM 8989 GN=C450_16440 PE=4 SV=1
MSKTRCGYVEDVELLTNRGTARCWRPVRGDDDRCFWHDGSPKTREALDSHRPEPGERLDGADLRGADLTGASWLRGRSLV
GADFTGATLRGTDLTGADCRRATFDRVDARRACFDGADVEGATFDDIDLREASLDGTKLYRASFTDVRLDRATDFGDRVI
YESLVDDAEDRETRVATLEAASWTYRELRRLFEQDALPQRSRACYLGEKSTRRRAAWAGGEYLRALKLEGSRWVMRYGTS
PTRVVTSSVVVMGCSGILYPLTGGLRTDSGTYGFEQPVADVLAATPGQLVRVFYNGLYFSVVTFSTLSYGDIQPIGAGAR
AIAGVEALLGSVLMALLLFVLTQRV