TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M4VE83|M4VE83_9DELT Macrolide-specific efflux protein OS=Bdellovibrio exovorus JSS GN=A11Q_2135 PE=4 SV=1
MNKKYVIISLVLAILIAGGVWFFFFKAKPTQYREAEIKKSDIALKILATGTVQPENRLQIKSPLAGRAESINVREGQKVK
KGEILAWVSSTERAVLLDGARAQGEAEVRKWEEIYKPTPIIAPLAGTIILRSIEPGQTFTTADAILVMADRLTIQAQVDE
TDLAQIFVKQKAEVVLDAYLNKPLEAVVSHIAYEAKTVNNVTTYTVYVLPLEEIDFLRSGMTANVNFIGESKQDITVVPN
AFVKYEAGRPYVLVKTGKEPENRPIRLGITDGKQTEVLSGLNAGDIVVEAIVAEKKNTSSGGISFGGPPGGRRR