TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O05347 PUTATIVE ATP-BINDING TRANSPORT PROTEIN - Synechococcus sp. (strain PCC 7942) (Anacystis nidulans R2).
MISEAVPAKEETGQAQLLIEQVGKVFTVNSPSLLDRLRQRSPKRYVALEDVNLTIASNTFVSIIGPSGCGKSTLLNLIAG
LDLPTSGQILLDGQRIRSPGPDRGIVFQNYALMPWMTALENVIFAVETARPNLSKSQAREVAREHLELVGLTKAADRYPG
QISGGMKQRVAIARALSIRPKLLLMDEPFGALDALTRGYLQEEVLRIWEANKLSVVLITHSIDEALLLSDRIVVMSRGPR
ATIREVIDLPAVRPRQRSVIEEDERFVKIKLRLEEHLFNETRAVEEASV