TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O09012|PEX5_MOUSE Peroxisomal targeting signal 1 receptor OS=Mus musculus GN=Pex5 PE=1 SV=2
MAMRELVEGECGGANPLMKLATHFTQDKALRQEGLRPGPWPPGASAAETVSKPLGVGTEDELVSEFLQDQNATLVSRAPQ
TFKMDDLLAEMQEIEQSNFRQAPQRAPGVADLALSENWAQEFLAAGDAVDVAQDYNETDWSQEFIAEVTDPLSVSPARWA
EEYLEQSEEKLWLGDQEGSSTADRWYDEYHPEEDLQHTASDFVSKVDDPKLANSEFLKFVRQIGEGQVSLESAAGSGGAQ
AEQWAAEFIQQQGTSEAWVDQFTRPGNKIAALQVEFERAKSAIESDVDFWDKLQAELEEMAKRDAEAHPWLSDYDDLTSA
SYDKGYQFEEENPLRDHPQPFEEGLHRLEEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLEL
KPDNRTALMALAVSFTNESLQRQACETLRDWLRYSPAYAHLVAPGEEGATGAGPSKRILGSLLSDSLFLEVKDLFLAAVR
LDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLMWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRY
NLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSALLAMFGLPQ