TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O32830 PLANTARICIN S BETA PROTEIN PRECURSOR - Lactobacillus plantarum.
MDKIIKFQGISDDQLNAVIGGKKKKQSWYAAAGDAIVSFGEGFLNAW