TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O34315|YTML_BACSU Probable amino-acid ABC transporter permease protein ytmL - Bacillus subtilis.
MEKAFDMNMIGDFVPTLTAYLPVTLYILTLSLLFGFVLGLFLALPRIYNIPIVNQLAKVYISFFRGTPIMVQLFIVFYGI
PALTGLIGIDTSKMDPFYAAVATYALSNAAAAAEIIRAGVGSVDKGQTEAAYSIGLSGSQAFRRIVLPQALVQAFPNMGN
MVISSLKDTSLAFSIGVMDMSGRGQTLITSSNHSLEVYIALSIVYYAVAVLFEWFFRVAEKRIKKNQTRIVTVFDMNIH