TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O34946|ADCC_BACSU Probable zinc transport system ATP-binding protein adcC OS=Bacillus subtilis GN=adcC PE=2 SV=1
MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTLIKVMLGMLKPWEGTVTISKRNTEGKRLTIGYVPQQ
ISSFNAGFPSTVLELVQSGRYTKGKWFKRLNEEDHLEVEKALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLM
LDEPTTAVDYDSRKGFYEFMHHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCLTWNSCDELF