TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O53655|O53655_MYCTU PROBABLE CONSERVED TRANSMEMBRANE PROTEIN OS=Mycobacterium tuberculosis GN=Rv0204c PE=4 SV=1
MSHDAPARNLRQRVGALPRTRVGAPPAEGVPPRGKYWWLRWAVLAIVAIVLAIEVALGWDQLAKAWVSLYRAKWWWLLAA
VAAAGASMHSFAQIQRTLLKSAGVHVKQWRSEAAFYAANSLSTTLPGGPVLSATFLLRQQRIWGASTVVASWQLVMSGVL
QAVGLALLGLGGAFFLGAKNNPFSLLFTLGGFVTLLLLAQAVASRPELIEGIGRRVLSWANSVRGRPADAGLPKWRETLM
QLESVSLGRRDLGVAFGWSLFNWIADVACLGFAAYAAGDHASVGGLAVAYAAARAVGTIPLMPGGVLVVEAVLVPGLVSS
GMPLPSAISAMLIYRLISWLLIAAIGWVVFFFMFRTESTADSDNDRDPPTDPNLRLVIQPQGTPCDDPVETTPQGPAPTP
DLRPEGGETPPR