TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O54396 PRISTINAMYCIN RESISTANCE PROTEIN VGAB - Staphylococcus aureus.
MLKIDMKNVKKYYADKLILNIKELKIYSGDKIGIVGKNGVGKTTLLKIIKGLIEIDEGNIIISEKTTIKYISQLEEPHSK
IIDGKYASIFQVENKWNDNMSGGEKTRFKLAEGFQDQCSLMLVDEPTSNLDIEGIELITNTFKEYRDTFLVVSHDRIFLD
QVCTKIFEIENGYIREFIGNYTNYIEQKEMLLRKQQEEYEKYNSKRKQLEQAIKLKENKAQGMIKPPSKTMGTSESRIWK
MQHATKQKKMHRNTKSLETRIDKLNHVEKIKELPSIKMDLPNREQFHGRNVISLKNLSIKFNNQFLWRDASFVIKGGEKV
AIIGNNGVGKTTLLKLILEKVESVIISPSVKIGYVSQNLDVLQSHKSILENVMSTSIQDETIARIVLARLHFYRNDVHKE
INVLSGGEQIKVAFAKLFVSDCNTLILDEPTNYLDIDAVEALEELLITYEGVVLFASHDKKFIQNLAEQLLIIENNKVKK
FEGTYIEYLKIKDKPKLNTNEKELKEKKMILEMQISSLLSKISMEENEEKNKELDEKYKLKLKELKSLNKNI