TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O54455 ENHANCER PEPTIDE FOR THERMOPHILIN 13 PRECURSOR - Streptococcus thermophilus.
MKQYNGFEVLHELDLANVTGGQINWGSVVGHCIGGAIIGGAFSGGAAAGVGCLVGSGKAIINGL