TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O67092|O67092_AQUAE Hydrogenase large subunit - Aquifex aeolicus.
MKRVVVDPVTRIEGHLRIEAEVKDGKITKAYSSGTMVRGIEIILKGRDPREAWAFAQRICGVCTTVHAIASVRAVEDALS
INVPVNASLLRKLIIGTIFVHDHVVHFYHLHLLDWVNPVQALKADPYETSRLAQSLSNYEKSTPGYFREVQKKIKQQVER
GQLGIFNKGYWNHPEYKLPPELNLMLIAHYLDALDWQTRIVQVHTIIGGKNPHPNFAVGGMAAPINPESDTAINMEKLGR
IKTLIDEMYDFTVKVYLPDIKVLGKYYKDWFFKGEGLGNFLVLGEPEKDSWREGKWFIPPTFIKGRNLKDFEEVNINEVK
EYVTHSWYKYSVGDDKPLHPWEGETNLNYTGPKPPYEYLNVEGKYSWLKAPRYKDYSVEVGPLSRILALYARDMYGIREE
VEKHLKEMDVPFEGMFSTMGRTFARALETKLYSFSMKNWFSELMENVKKGNYDVFNPEKWEPSTWPKETKGVGFMEAPRG
SLSHWVHIKDGKLENYQAVVPTTWNASPRDAKGNPSAYEASLVGHSLHNPKEPVEILRTIHSFDPCLACAVHLYGDEEME
IRVV