TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O67095|O67095_AQUAE Hydrogenase small subunit - Aquifex aeolicus.
MESLYEIFKRKGYSRRDFLKFSLAVSAFLGLPPSLYPKVAQALEKKEKPVVIWLEFQDCAGCSESFIRSTTLLPTEVLLD
YISLEYHETLMAPSGFYAEEAREEAIKKYKGKYVLVVEGSPTPADGGVYCTVGGKSSVDILRETAEHAAFVIAVGSCASW
GGIPKASPNPTGAVPVYEIVKDKPVVNVPGCPPIGDVMVATIVHFLALGKLPPLDELGRPKQFYGETIHDRCYRRAFYNS
GQFAESFDDEKARKGYCLYKLGCKGPITRNACASMRWNGGLSFPIQSGHPCFGCSEPDFWDRGFIYNPLSVMEGYSGISD
TLKGVGIGAAVGIGIGVLNKLINKKKEEK