TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O69194 STREPTOLYSIN S ASSOCIATED PROTEIN SAGA - Streptococcus pyogenes.
MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGGSGSYTPGK