TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O80634|PPL2_ARATH PsbP-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=PPL2 PE=1 SV=2
MAVSSLSIRCGGFSPTISHKTEILCPNPSLKACCLLSSGGKADSSESTYQKGSGNNWKRRQALVGVGTLVATSIPATLLL
AEEIPKSYSPFVDREDGYSYYYPSDWREFDFRAHDSAFKDRYLQLQNVRVRFIPTEKNDIHEVGPMEEVVYDLVKHKFAA
PNQVATIYDMKERVEDGKNYYTFEYGLRTPIYATTSFATVAVGNNRYYTLIVGANERRWRKVKKQLQVVADSLKILQI