TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O81765|PLRX4_ARATH Pollen-specific leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=PEX4 PE=2 SV=1
MPFYKQPWVFSKVFVLAMAKPPSFGCCFFLLFFSFLSSSFVSFALTDTEAAFIVQRQLLTLPDNGELPDDIEYEVDLKAT
FANTRLKRAYIALQAWKKAIFSDPFNTTGNWHGPHVCGYTGVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDV
AMFHLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPNVVLSWPDVKYFDLRFNDFEGQVPPELFKKELDAIFLNDNR
FTSVIPESLGESPASVVTFANNKFTGCIPKSIGNMKNLNEIVFMDNDLGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSF
VGLTSVEEIDISGNKLTGLVPHNICQLPNLVNLTYSYNYFSGQGGSCVPGGSRKEIALDDTRNCLASRPEQRSAQECAVV
INRPVDCSKDKCAGGSSTPSKPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPV
DKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPP
PPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSP
PPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPPMFAGY