TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O83341|O83341_TREPA Ribose/galactose ABC transporter, ATP-binding protein (RbsA-2) - Treponema pallidum.
MPYAVEMRDVTVRFPGVVANDCVSFGVQTAEVHALLGENGAGKSTLMGVLFGTCPKQSGELFVDGRSVCIRSPRDAARHG
IGMVHQHFNLVHNLTVSENIVLGVEPRARFARTDVRAAHRAVGELCERYGLAVDPYAKIQDITVGMQQRVEILKMLYRDA
RVLIFDEPTAVLAPQEVQQLMQVIRRLAREGKAVVLITHKLSEIKAIADRCTVLRRGACIGTVSVAEVGEERLVEMMVGH
AVDYALPRASRKDGACVLEVRSLSVGARRVTSGQMWADASPSAAPRAYGVRAVSFQVRCGEILCITGVDGNGQSQLLEAI
AGLVPVSEGQILLDGCEIQRTSVRERVLRGVSYIPEDRRKHGLVLDFSVEENMVLRSYFRAPFARRGILDRRVIAQHAHA
LAKKFEVQSGALGCAVRARTLSGGNQQKVIIARELHRAPRLLIAAQPTRGLDLGAVQYVHRAIVAERNRGGAVLLFSLDM
DEVLALADSIAVMYEGEIVGTVHACDATEQELGRLMSGMRKKETAGKKTGVQG