TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O86506|O86506_STRCO Putative transmembrane transport protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5524 PE=4 SV=1
MPIEQRGVDTIPEAERTSGPRDLVSILLGSNLCLGVIVFGWLPPSFGLGWWASVSSVVAGTVVGTVFTAPLALISLRTGT
NLSTSSGAQFGVRGRLVGSVVGLLLALGYTALTVWIGGDVMAGVLGRLFGLPQGGATYAVVYGLLAAATVAGAVYGYRVL
LAMSRVLAYGMTALLVLGVIAYAPDFTTAALPEAGGYLLGGFWPTWLLAAVAAGLSGPIAFITLLGDYTRYISPARHSSR
RVLRATWLGLTLGLLVPQLFGTFTAYAAGAALDYAGPLVDASPTWYLVPLLLAASAGSVGNAGLMLYSMGLDLDAILPRA
SRARATCAVAVVATACVFAGHYAWQAQSAMTSFVLLLTAIGTPWAVITMIGSVRCGGVYDADALQVFNRRARGGIYWYRS
GWNVPATAAWAVGALVGVLAVSLPSYEGPLLSLTGGVDCSFLLSGLVGGAVYVLLPQPRAASPKEPGVGNLSPSGV