TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O96386|O96386_PARTE Potassium channel PAK11 protein OS=Paramecium tetraurelia GN=PAK11-MAC PE=4 SV=2
MIPGLQKIRFRKEEQEKMEDQEIELDALNKVDRQLEMLENSSVWKSKPLRIIQKITIFITRLKHSSTTYRFKLLKKSIFL
LIRDKASSFQYYLNNYMLFQKPTRWIQIKYEAHASNPLWWRFWCFLKSDETVLLPADKFLFVWDLLMMLVTIANIFYVPL
QLSFNLNEDDMGSIFTLFSTLPSCIFLIDLILTFFKGYYDRGILQRNKAKIFRHYIKGDFLLDLAIVLPFILSWMGYSAA
NYLMLIRMTRVRRTMIVIEEISNFKEKSAIIYQLFCLIYSLLLISHFCACLFHYFALYEVDQGYTHTWLHQQNIFDEDLY
TKYFNSLYWITITSMTVGYGDIVPVTTPEKILVTIITFLVTGVFGYALGMIQSIFYEMAEQTNINNSRLRLVSNHIKQRG
LNTQLQFRVRKYIEYYLQFKQDEELDLDELMGQLNPKLKQEVQIAMYYRYLKHSKLFGTNFSDDLIKKLCFCIHERTFAP
EEVIIRKDELPNQLYIVLAGQVKSLILEKSIKRYQQGNLLCEREFFYQDFMQYNIVASSFVQVAYLNLSEFQSIIQNHRS
SFEQYRYAIDNTVFGQNTNLIICEACQSHHQFKNCPLVFFKKNTYKVLAACHSNHVQSRQTFARKKSKYKQQRTGVLNGA
YDHIIKMRTQLGVQIDQAFLNKIGYPGYEQQQQSDEEEDKYQSPQARRQSFSQFNDHQHSLSQNTLPQDEHYNDFDIDKV
EEYEFYYPHDNITKISKIVNKQQLLQRLLDKVSNKKNLFAGLVFRQVVQNII