TCDB is operated by the Saier Lab Bioinformatics Group
>OLS24633.1 High-affinity branched-chain amino acid transport ATP-binding protein LivF [Candidatus Heimdallarchaeota archaeon LC_3]
MLTVDNVVSGYGKAIICQGISLTVEAGELVTVIGPNGSGKSTLLKTITGLVKTISGRISFNSSNITNLNSTTLPKIGLGY
VPQLDNVFFNMSIIENLEMGSLHNKEDFDKNLGVVHRIFPILQEREKEKAKKLSGGERQMLALARALVGGPKMLLLDEPT
AALSPALSIEILEIVKKLTKVEGIPILLIEQNARKSLQISDRAYILTNGQVFRTGKAKDILSDENIGKAFLGA