TCDB is operated by the Saier Lab Bioinformatics Group
>OLS28084.1 hypothetical protein HeimC3_00440 [Candidatus Heimdallarchaeota archaeon LC_3]
MKVNKKVLFGLLILAAFSTFFWSTSSTVVAETAGTNQAKSDQFWIDNRGYVDQIVYKVITQDELLVEATRTGEIDIVGQF
VDVALLKPSDLADPDLGLTQTRRRGFGHITFNNQEFPSSVRAMRQGFAYALDKVELQQRALGGASFTADSVIVGSLGIWS
CEYEFTLSPCSPSSETYYDPQVGLGNTTILNAGFYDFNGDGFREYFTGNVTDSTLGLIWSGSSVAQGNVLGTASGYPDPN
WNGYTYLGGDGTRRTFAEVNVVMNGDPLGPGSSGASALATGMADSANWEDVEFIITGSAGSNIVTIVVTMVSEGFYAMGI
KGNTEFITFAALLQKMDAGDFVGLFFAYSGMAPNPTFLQIFDGESVTNTQRARWYNDTFDALWDIIDQSSDFDEVIQAGF
DAQQIYWQEQPMVVMYNNELTSLYRTDKFDGFVTVPGEGAFGYDSSIKVHLKNTLENWDKYPNYPLGGTYVFGLAQPMDS
HNSMNSNNAYTRDVLGTIEEYLFGLNPEDLTRIPSGLASDFTIEAPYTDDAATKAANPDAMIINGSKFTFNLLNNVTWHN
GENFTSADVAFSFEVLKTNVSPVYFDNLEHIPFERIETPNDYQVIIYSNSSGLFEFANTGVPIYQKSYWSQFNDVVNHDN
PVPQGTGPYKWVASTPGEFYLQERNDDYYRKPTVDSFLKYFTKPTGVTTTPTTTTTTSGTTTTDEPSPAPGFEILVTLAG
MMVVSVIFLKLRRR