TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P05528|MCBE_ECOLI MCBE protein - Escherichia coli.
MVTLKMAIIFLMEQIRTPFSLIWTIMSPTVLFFFLHFNEIELHYGDTAWLGKQISWFVGYISFSVVLFNYCLYLVGRRES
GFIATFVHNMDGRLLFIRSQLIASLIMSILYVFFFILVVLTGFQASPDYQIVMIILKSIYINAFMMVSLTFMASFRVTFQ
TASTIYSVLITVCMVSGIVSLKYNEGIVYWINQVNPIAIYSTILQSDQELSLMTIFFYSIMLIISIISALTFKTEPVWSS
Q