TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P06624|MIP_BOVIN Lens fiber major intrinsic protein (MIP26) (MP26) - Bos taurus (Bovine).
MWELRSASFWRAICAEFFASLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQ
MSLLRAICYMVAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPGVSVGQATIVEIFLTLQFVLCIFATYDERRNGRLGSV
ALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPVIGAGLGSLLYDFLLFPRLKSVSERLSILKGS
RPSESNGQPEVTGEPVELKTQAL