TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P08716|HLYB_ECOLI Hemolysin secretion ATP-binding protein, plasmid - Escherichia coli.
MDSCHKIDYGLYALEILAQYHNVSVNPEEIKHRFDTDGTGLGLTSWLLAAKSLELKVKQVKKTIDRLNFIFLPALVWRED
GRHFILTKISKEVNRYLIFDLEQRNPRVLEQSEFEALYQGHIILITSRSSVTGKLAKFDFTWFIPAIIKYRRIFIETLVV
SVFLQLFALITPLFFQVVMDKVLVHRGFSTLNVITVALSVVVVFEIILSGLRTYIFAHSTSRIDVELGAKLFRHLLALPI
SYFESRRVGDTVARVRELDQIRNFLTGQALTSVLDLLFSLIFFAVMWYYSPKLTLVILFSLPCYAAWSVFISPILRRRLD
DKFSRNADNQSFLVESVTAINTIKAMAVSPQMTNIWDKQLAGYVAAGFKVTVLATIGQQGIQLIQKTVMIINLWLGAHLV
ISGDLSIGQLIAFNMLAGQIVAPVIRLAQIWQDFQQVGISVTRLGDVLNSPTESYHGKLTLPEINGDITFRNIRFRYKPD
SPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSII
DNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYES
EHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD