TCDB is operated by the Saier Lab Bioinformatics Group
>P0A1I1|PHSB_SALTY Thiosulfate reductase electron transport protein phsB - Salmonella typhimurium.
MNHLTNQYVMLHDEKRCIGCQACTVACKVLNDVPEGFSRVQVQIRAPEQASNALTHFQFVRVSCQHCENAPCVSVCPTGA
SYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADKCNFCADTRLAAGQSPACVSVCPTDALKFGRLDESEIQR
WVGQKEVYRQQEARSGAVSLYRRKEVHQEGKA